Caveolin-1 anticorps (N-Term)

N° du produit ABIN631128

Cet anticorps anti-Caveolin-1 est un anticorps Lapin Polyclonal détectant Caveolin-1 dans WB. Adapté pour Humain.

Aperçu rapide pour Caveolin-1 anticorps (N-Term) (ABIN631128)

Antigène: Caveolin-1 (CAV1) (Caveolin 1, Caveolae Protein, 22kDa (CAV1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Caveolin-1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Caveolin-1 anticorps

Épitope: N-Term

Specificité: CAV1 antibody was raised against the N terminal of CAV1

Purification: Affinity purified

Immunogène: CAV1 antibody was raised using the N terminal of CAV1 corresponding to a region with amino acids SGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CAV1 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this CAV1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CAV1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Caveolin-1

Antigène: Caveolin-1 (CAV1) (Caveolin 1, Caveolae Protein, 22kDa (CAV1))

Autre désignation: CAV1

Sujet: The scaffolding protein CAV1 is the main component of the caveolae plasma membranes found in most cell types. The protein links integrin subunits to the tyrosine kinase FYN, an initiating step in coupling integrins to the Ras-ERK pathway and promoting cell cycle progression. The gene is a tumor suppressor gene candidate and a negative regulator of the Ras-p42/44 MAP kinase cascade. CAV1 and CAV2 are located next to each other on chromosome 7 and express colocalizing proteins that form a stable hetero-oligomeric complex. By using alternative initiation codons in the same reading frame, two isoforms (alpha and beta) are encoded by a single transcript from this gene.

Poids moléculaire: 20 kDa (MW of target protein)

Pathways: Maintenance of Protein Location, Signaling Events mediated by VEGFR1 and VEGFR2, Negative Regulation of Transporter Activity, VEGFR1 Specific Signals